Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).

2024年1月17日 · GLP-2 analogs work in the following ways: They are analogs of naturally occurring human GLP-2 hormone. GLP-2 increases intestinal and portal blood flow and inhibits gastric acid secretion. They improve the intestinal absorption of fluids and nutrients.

Glucagon-like peptide 2 (GLP-2) is a 33 amino acid peptide-encoded carboxyterminal to the sequence of GLP-1 in the proglucagon gene. Both GLP-1 and GLP-2 are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms of action.

The most apparent role for GLP-2 is its promotion of growth and function of intestinal mucosa, which has been targeted for therapies that promote repair and adaptive growth. These are used as treatments for intestinal failure and related conditions.

2 天之前 · GLP-2 enhances nutrient absorption by expanding the absorptive surface and increasing villus height and crypt depth. This structural adaptation allows for greater contact between nutrients and brush border enzymes, improving digestion and uptake. Additionally, GLP-2 regulates key nutrient transporters in enterocytes.

Glucagon-like peptide 2 [GLP-2] is a 33-amino acid peptide released from the mucosal enteroendocrine L-cells of the intestine. The actions of GLP-2 are transduced by the GLP-2 receptor [GLP-2R], which is localized in the neurons of the enteric nervous system but not in the intestinal epithelium, ind …

Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene.

Glucagon like peptide-2 (GLP-2) is a gastrointestinal hormone released from enteroendocrine L-type cells together with glucagon like peptide-1 in response to dietary nutrients. GLP-2 acts through a specific receptor, the GLP-2 receptor, mainly located in the gut and in the brain.

Human GLP-2 (hGLP-2) is a systemic nutrient peptide hormone derived from proglucagon. It contains 33 amino acids; it is expressed, transcribed, and translated from the glucagon motif; and it is secreted by L-type endocrine cells in the distal small intestine and colon.

2014年11月1日 · GLP-2 is a neurondocrine signal arising from the gastrointestinal tract with trophic action. The GLP-2 receptor is expressed in the enteric nervous system. GLP-2 is a protective signalling during inflammatory state. GLP-2 study has led to innovative treatment for Short Bowel Syndrome and could lead to other relevant applications.